PDB entry 2zqq

View 2zqq on RCSB PDB site
Description: Crystal structure of human AUH (3-methylglutaconyl-coa hydratase) mixed with (AUUU)24A RNA
Class: lyase
Keywords: BETA SPIRAL, LYASE, Branched-chain amino acid catabolism, Disease mutation, Mitochondrion, RNA-binding, Transit peptide, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2008-08-16, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqa_
  • Chain 'B':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqb_
  • Chain 'C':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqc_
  • Chain 'D':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqd_
  • Chain 'E':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqe_
  • Chain 'F':
    Compound: Methylglutaconyl-CoA hydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: AUH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zqqf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqqA (A:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqA (A:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqqB (B:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqB (B:)
    delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
    gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
    dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
    shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
    tiptkdrlegllafkekrpprykge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zqqC (C:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqC (C:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zqqD (D:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqD (D:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zqqE (E:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqE (E:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelala
    cdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgl
    ishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacya
    qtiptkdrlegllafkekrpprykge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zqqF (F:)
    ssemktedelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrti
    iirsevpgifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggg
    lelalacdirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgke
    akavglishvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglai
    eeacyaqtiptkdrlegllafkekrpprykge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqqF (F:)
    edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsev
    pgifcagasevgpfvskiravindianlpvptiaaidglalggglelalacdirvaassa
    kmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavglishvleqnqe
    gdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaqtiptkdrle
    gllafkekrpprykge