PDB entry 2zqk

View 2zqk on RCSB PDB site
Description: Crystal structure of intimin-Tir68 complex
Class: Cell Adhesion
Keywords: protein-protein complex, unique intimin-Tir trimer intermediate, Cell membrane, Cell outer membrane, Membrane, Transmembrane, Virulence, Receptor, Cell Adhesion
Deposited on 2008-08-12, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intimin
    Species: Escherichia coli [TaxId:83334]
    Gene: intimin adherence protein 747-934
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqka1, d2zqka2
  • Chain 'B':
    Compound: intimin
    Species: Escherichia coli [TaxId:83334]
    Gene: intimin adherence protein 747-934
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqkb1, d2zqkb2
  • Chain 'C':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:83334]
    Gene: Tir 269-336
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:83334]
    Gene: Tir 269-336
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:83334]
    Gene: Tir 269-336
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
    Species: Escherichia coli [TaxId:83334]
    Gene: Tir 269-336
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqkA (A:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqkA (A:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqkB (B:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqkB (B:)
    tffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasg
    kvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvls
    diydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvya
    vcve
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.