PDB entry 2zqj

View 2zqj on RCSB PDB site
Description: Substrate-Free Form of Cytochrome P450BSbeta
Class: oxidoreductase
Keywords: Peroxigenese, Oxidoreductase, Heme protein, Substrate-free form, Heme, Iron, Metal-binding, Monooxygenase
Deposited on 2008-08-11, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 152A1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cypC, CYP152A1, BSU02100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqja_
  • Chain 'B':
    Compound: Cytochrome P450 152A1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cypC, CYP152A1, BSU02100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqjb_
  • Chain 'C':
    Compound: Cytochrome P450 152A1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cypC, CYP152A1, BSU02100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zqjc_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqjA (A:)
    mneqiphdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfyd
    tdrfqrqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewk
    aavtrwekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprh
    wkgrrarpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinv
    lrpivaisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkd
    fvwnncefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekg
    hrcpgegitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqjA (A:)
    phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
    rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
    wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
    arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
    aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
    cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
    egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqjB (B:)
    mneqiphdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfyd
    tdrfqrqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewk
    aavtrwekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprh
    wkgrrarpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinv
    lrpivaisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkd
    fvwnncefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekg
    hrcpgegitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqjB (B:)
    phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
    rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
    wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
    arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
    aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
    cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
    egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zqjC (C:)
    mneqiphdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfyd
    tdrfqrqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewk
    aavtrwekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprh
    wkgrrarpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinv
    lrpivaisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkd
    fvwnncefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekg
    hrcpgegitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqjC (C:)
    phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
    rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
    wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
    arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
    aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
    cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
    egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk