PDB entry 2zqc

View 2zqc on RCSB PDB site
Description: Aztreonam acyl-intermediate structure of class a beta-lactam Toho-1 E166A/R274N/R276N triple mutant
Class: hydrolase
Keywords: EXTENDED-SPECTRUM, ESBL, BETA-LACTAMASE, ACYL-ENZYME COMPLEX, AZTREONAM, TOHO-1, HYDROLASE, Antibiotic resistance
Deposited on 2008-08-07, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.134
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase toho-1
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (Start-261)
      • engineered (139)
      • engineered (245)
      • engineered (247)
    Domains in SCOPe 2.01: d2zqca_
  • Heterogens: SO4, AZR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqcA (A:)
    ansvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaenrndilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqcA (A:)
    nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
    khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
    vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
    vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
    qkaenrndilaaaakivthgf