PDB entry 2zqb

View 2zqb on RCSB PDB site
Description: Crystal structure of a psychrotrophic RNaseHI variant with sextuple thermostabilizing mutations
Class: hydrolase
Keywords: HYDROLASE, Cytoplasm, Endonuclease, Magnesium, Metal-binding, Nuclease
Deposited on 2008-08-07, released 2009-06-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EE30
      • engineered (28)
      • engineered (38)
      • engineered (75)
      • engineered (89)
      • engineered (96)
      • engineered (135)
    Domains in SCOPe 2.01: d2zqba_
  • Chain 'B':
    Compound: ribonuclease hi
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EE30
      • engineered (28)
      • engineered (38)
      • engineered (75)
      • engineered (89)
      • engineered (96)
      • engineered (135)
    Domains in SCOPe 2.01: d2zqbb_
  • Chain 'C':
    Compound: ribonuclease hi
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EE30
      • engineered (28)
      • engineered (38)
      • engineered (75)
      • engineered (89)
      • engineered (96)
      • engineered (135)
    Domains in SCOPe 2.01: d2zqbc_
  • Chain 'D':
    Compound: ribonuclease hi
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EE30
      • engineered (28)
      • engineered (38)
      • engineered (75)
      • engineered (89)
      • engineered (96)
      • engineered (135)
    Domains in SCOPe 2.01: d2zqbd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zqbA (A:)
    mtelklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalea
    lkepckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidw
    rwvkghaghaenerchqlaraaaeanptqidtgyqaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqbA (A:)
    elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
    epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
    vkghaenerchqlaraaaeanptqidtgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zqbB (B:)
    mtelklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalea
    lkepckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidw
    rwvkghaghaenerchqlaraaaeanptqidtgyqaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqbB (B:)
    lklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealke
    pckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrwv
    kgaenerchqlaraaaeanptqidtgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zqbC (C:)
    mtelklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalea
    lkepckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidw
    rwvkghaghaenerchqlaraaaeanptqidtgyqaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqbC (C:)
    lklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealke
    pckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrwv
    kghaghaenerchqlaraaaeanptqidtgy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zqbD (D:)
    mtelklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalea
    lkepckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidw
    rwvkghaghaenerchqlaraaaeanptqidtgyqaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zqbD (D:)
    elklihiftdgsclgnpgpggygivmkykghtkemsggfslttnnrmellapivalealk
    epckiiltsdsqyvrqgimtwihgwkkngwmtsngtpvknvdlwkrldkaaqlhqidwrw
    vkghaghaenerchqlaraaaeanptqidtgy