PDB entry 2zq8

View 2zq8 on RCSB PDB site
Description: Apo structure of class a beta-lactamase Toho-1 R274N/R276N double mutant
Class: hydrolase
Keywords: EXTENDED-SPECTRUM, ESBL, BETA-LACTAMASE, TOHO-1, HYDROLASE, Antibiotic resistance, Plasmid
Deposited on 2008-08-07, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.138
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase toho-1
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (Start-261)
      • engineered (245)
      • engineered (247)
    Domains in SCOPe 2.01: d2zq8a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zq8A (A:)
    ansvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaenrndilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zq8A (A:)
    nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
    khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
    vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
    vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
    qkaenrndilaaaakivthgf