PDB entry 2zq2

View 2zq2 on RCSB PDB site
Description: Exploring trypsin S3 pocket
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase inhibitors, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2008-08-03, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zq2a_
  • Heterogens: CA, 13U, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zq2A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn