PDB entry 2zpy

View 2zpy on RCSB PDB site
Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide
Class: cell adhesion
Keywords: FERM domain, CD44, Actin capping, Actin-binding, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Phosphoprotein, Structural protein, Alternative splicing, Cell adhesion, Glycoprotein, Proteoglycan, Pyrrolidone carboxylic acid, Receptor, Sulfation, Transmembrane
Deposited on 2008-07-31, released 2008-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Gene: Rdx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zpya1, d2zpya2, d2zpya3
  • Chain 'B':
    Compound: CD44 antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpyA (A:)
    gpmpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystw
    lklnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycp
    petavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwhee
    hrgmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpki
    gfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpd
    tievqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpyA (A:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'B':
    No sequence available.