PDB entry 2zpx

View 2zpx on RCSB PDB site
Description: TNF Receptor Subtype One-selective TNF Mutant with Antagonistic Activity; R1antTNF-T8
Class: cytokine
Keywords: Tumor necrosis factor, Trimer, Antagonistic activity, TNFR1 specific, Phage display system, Cytokine, Cell membrane, Lipoprotein, Membrane, Myristate, Phosphoprotein, Polymorphism, Secreted, Signal-anchor, Transmembrane
Deposited on 2008-07-29, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.268
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.07: d2zpxa_
  • Chain 'B':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.07: d2zpxb_
  • Chain 'C':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.07: d2zpxc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpxA (A:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisritpainrpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpxA (A:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisritpainrpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zpxB (B:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisritpainrpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpxB (B:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisritpainrpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zpxC (C:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisritpainrpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpxC (C:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisritpainrpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfaesgqvyfgiial