PDB entry 2zpr

View 2zpr on RCSB PDB site
Description: Crystal structure of anionic trypsin isoform 2 from chum salmon
Class: hydrolase
Keywords: serine proteinase, trypsin, hydrolase, Protease, Serine protease
Deposited on 2008-07-28, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.206
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic trypsin
    Species: Oncorhynchus keta [TaxId:8018]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AV11 (0-End)
      • see remark 999 (46)
      • see remark 999 (130-131)
    Domains in SCOPe 2.01: d2zpra_
  • Chain 'B':
    Compound: anionic trypsin
    Species: Oncorhynchus keta [TaxId:8018]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AV11 (0-End)
      • see remark 999 (46)
      • see remark 999 (130-131)
    Domains in SCOPe 2.01: d2zprb_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zprA (A:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zprA (A:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zprB (B:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zprB (B:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvavrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadgdklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmat