PDB entry 2zpq

View 2zpq on RCSB PDB site
Description: Crystal structure of anionic trypsin isoform 1 from chum salmon
Class: hydrolase
Keywords: serine proteinase, trypsin, hydrolase, Protease, Serine protease
Deposited on 2008-07-28, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anionic trypsin
    Species: Oncorhynchus keta [TaxId:8018]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zpqa_
  • Chain 'B':
    Compound: anionic trypsin
    Species: Oncorhynchus keta [TaxId:8018]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpqA (A:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpqA (A:)
    ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
    wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstma
    

  • Chain 'B':
    No sequence available.