PDB entry 2zpn

View 2zpn on RCSB PDB site
Description: The crystal structure of Saccharomyces cerevisiae Atg8- Atg19(412-415) complex
Class: protein transport
Keywords: ubiquitin fold, Autophagy, Cytoplasmic vesicle, Lipoprotein, Membrane, Protein transport, Transport, Ubl conjugation pathway, Vacuole
Deposited on 2008-07-17, released 2008-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zpna_
  • Chain 'B':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zpnb_
  • Chain 'C':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zpnc_
  • Chain 'D':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zpnd_
  • Chain 'E':
    Compound: Saccharomyces cerevisiae Atg19(412-415)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZPN (0-3)
  • Chain 'F':
    Compound: Saccharomyces cerevisiae Atg19(412-415)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZPN (0-3)
  • Chain 'G':
    Compound: Saccharomyces cerevisiae Atg19(412-415)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZPN (0-3)
  • Chain 'H':
    Compound: Saccharomyces cerevisiae Atg19(412-415)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZPN (0-3)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpnA (A:)
    gahmkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpnA (A:)
    mkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqf
    vyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zpnB (B:)
    gahmkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpnB (B:)
    tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv
    irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zpnC (C:)
    gahmkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpnC (C:)
    tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv
    irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zpnD (D:)
    gahmkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpnD (D:)
    tfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvgqfvyv
    irkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysge
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.