PDB entry 2zph

View 2zph on RCSB PDB site
Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293K
Class: lyase
Keywords: LYASE, Iron, Metal-binding, Oxidation
Deposited on 2008-07-11, released 2008-10-21
The last revision prior to the SCOP 1.75 freeze date was dated 2008-12-16, with a file datestamp of 2008-12-12.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.158
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2zphb1
  • Heterogens: FE, TB0, MG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zphB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zphB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa