PDB entry 2zpe

View 2zpe on RCSB PDB site
Description: nitrosylated Fe-type nitrile hydratase with tert-butylisonitrile
Class: Lyase
Keywords: Lyase, Iron, Metal-binding, Oxidation
Deposited on 2008-07-10, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-16, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.167
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zpea_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zpeb_
  • Heterogens: FE, NO, MG, TB0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpeA (A:)
    svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelv
    arawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpil
    glpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagteg
    wsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpeA (A:)
    enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zpeB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpeB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa