PDB entry 2zpd

View 2zpd on RCSB PDB site
Description: Crystal structure of the R43L mutant of LolA in the open form
Class: protein transport
Keywords: unclosed beta barrel, Chaperone, Periplasm, Protein transport, Transport
Deposited on 2008-07-10, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: lolA, lplA, yzzV, b0891, JW0874
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61316 (0-181)
      • engineered (42)
      • expression tag (182)
    Domains in SCOPe 2.06: d2zpda1, d2zpda2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zpdA (A:)
    daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvklpnlfnwhmtqpdesilv
    sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
    ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
    rklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zpdA (A:)
    daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvklpnlfnwhmtqpdesilv
    sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
    ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
    rkl