PDB entry 2zp6

View 2zp6 on RCSB PDB site
Description: Crystal structure of Bovine Insulin (Hexameric form)
Class: Hormone
Keywords: Hexameric form, Carbohydrate metabolism, Cleavage on pair of basic residues, Glucose metabolism, Hormone, Secreted
Deposited on 2008-06-27, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-20)
• Chain 'B':
  Compound: insulin B chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-29)
  Domains in SCOPe 2.08: d2zp6b1
• Chain 'C':
  Compound: insulin A chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-20)
• Chain 'D':
  Compound: insulin B chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-29)
  Domains in SCOPe 2.08: d2zp6d1
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zp6B (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zp6D (D:)
  fvnqhlcgshlvealylvcgergffytpka