PDB entry 2zp5

View 2zp5 on RCSB PDB site
Description: Carboxylic ester hydrolase, single mutant d49k of bovine pancreatic pla2 enzyme
Class: hydrolase
Keywords: HYDROLASE, ACTIVE SITE MUTANT, METAL BINDING PROTEIN, Calcium, Lipid degradation, Metal-binding, Pyrrolidone carboxylic acid, Secreted
Deposited on 2008-06-27, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (48)
    Domains in SCOPe 2.08: d2zp5a_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zp5A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthkncykqakklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    knc