PDB entry 2zoz

View 2zoz on RCSB PDB site
Description: Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor CgmR
Class: transcription
Keywords: helix turn helix, DNA-binding, Transcription, Transcription regulation
Deposited on 2008-06-20, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: cgl2612
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zoza1, d2zoza2
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: cgl2612
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NMG3 (0-174)
      • expression tag (175-180)
    Domains in SCOPe 2.07: d2zozb1, d2zozb2, d2zozb3
  • Heterogens: ET, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zozA (A:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipselhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zozA (A:)
    tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd
    wdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwip
    dtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zozB (B:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipselhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zozB (B:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipselhhh
    h