PDB entry 2zow

View 2zow on RCSB PDB site
Description: Crystal Structure of H2O2 treated Cu,Zn-SOD
Class: oxidoreductase
Keywords: metalloprotein, dismutase, SOD, Acetylation, Antioxidant, Copper, Cytoplasm, Metal-binding, Oxidoreductase, Zinc
Deposited on 2008-06-11, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.196
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zowa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2zowb_
  • Heterogens: ZN, CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zowA (A:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zowB (B:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak