PDB entry 2zoq

View 2zoq on RCSB PDB site
Description: Structural dissection of human mitogen-activated kinase ERK1
Class: transferase
Keywords: serine/threonine kinase, ERK1, Acetylation, ATP-binding, Cell cycle, Host-virus interaction, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-06-01, released 2009-04-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK3, ERK1, PRKM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zoqa_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK3, ERK1, PRKM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zoqb_
  • Heterogens: SO4, NA, 5ID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zoqA (A:)
    lgsmaaaaaqgggggeprrtegvgpgvpgevemvkgqpfdvgprytqlqyigegaygmvs
    saydhvrktrvaikkispfehqtycqrtlreiqillrfrhenvigirdilrastleamrd
    vyivqdlmetdlykllksqqlsndhicyflyqilrglkyihsanvlhrdlkpsnllintt
    cdlkicdfglariadpehdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilae
    mlsnrpifpgkhyldqlnhilgilgspsqedlnciinmkarnylqslpsktkvawaklfp
    ksdskaldlldrmltfnpnkritveealahpyleqyydptdepvaeepftfamelddlpk
    erlkelifqetarfqpgvleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zoqA (A:)
    vpgevemvkgqpfdvgprytqlqyigegaygmvssaydhvrktrvaikkispfehqtycq
    rtlreiqillrfrhenvigirdilrastleamrdvyivqdlmetdlykllksqqlsndhi
    cyflyqilrglkyihsanvlhrdlkpsnllinttcdlkicdfglariadpehdhtgflte
    yvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgs
    psqedlnciinmkarnylqslpsktkvawaklfpksdskaldlldrmltfnpnkritvee
    alahpyleqyydptdepvaeepftfamelddlpkerlkelifqetarfqpgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zoqB (B:)
    lgsmaaaaaqgggggeprrtegvgpgvpgevemvkgqpfdvgprytqlqyigegaygmvs
    saydhvrktrvaikkispfehqtycqrtlreiqillrfrhenvigirdilrastleamrd
    vyivqdlmetdlykllksqqlsndhicyflyqilrglkyihsanvlhrdlkpsnllintt
    cdlkicdfglariadpehdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilae
    mlsnrpifpgkhyldqlnhilgilgspsqedlnciinmkarnylqslpsktkvawaklfp
    ksdskaldlldrmltfnpnkritveealahpyleqyydptdepvaeepftfamelddlpk
    erlkelifqetarfqpgvleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zoqB (B:)
    vpgevemvkgqpfdvgprytqlqyigegaygmvssaydhvrktrvaikkispfehqtycq
    rtlreiqillrfrhenvigirdilrastleamrdvyivqdlmetdlykllksqqlsndhi
    cyflyqilrglkyihsanvlhrdlkpsnllinttcdlkicdfglariadpehdhtgflte
    yvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgs
    psqedlnciinmkarnylqslpsktkvawaklfpksdskaldlldrmltfnpnkritvee
    alahpyleqyydptdepvaeepftfamelddlpkerlkelifqetarfqpgv