PDB entry 2zoi

View 2zoi on RCSB PDB site
Description: Neutron Crystal Structure of Photoactive Yellow Protein, Wild type, at 295K
Class: signaling protein
Keywords: PAS, LOV, PHOTORECEPTOR, LIGHT SENSOR, LBHB, SHB, Chromophore, Photoreceptor protein, Receptor, Sensory transduction, SIGNALING PROTEIN
Deposited on 2008-05-21, released 2009-03-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zoia_
  • Heterogens: HC4, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zoiA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv