PDB entry 2zoa

View 2zoa on RCSB PDB site
Description: Malonate-bound structure of the glycerophosphodiesterase from Enterobacter aerogenes (GpdQ) COLLECTED AT 1.280 ANGSTROM
Class: hydrolase
Keywords: malonate, metalloenzyme, iron, phosphodiesterase, hydrolase
Deposited on 2008-05-07, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.16
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphohydrolase
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: GpdQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XBH1 (0-End)
      • see remark 999 (223)
      • see remark 999 (226)
    Domains in SCOPe 2.08: d2zoaa_
  • Chain 'B':
    Compound: Phosphohydrolase
    Species: Enterobacter aerogenes [TaxId:548]
    Gene: GpdQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XBH1 (0-End)
      • see remark 999 (223)
      • see remark 999 (226)
    Domains in SCOPe 2.08: d2zoab_
  • Heterogens: FE2, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zoaA (A:)
    mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
    qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
    ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
    lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
    rqvgeqwvsyqhslahyagpwlydeniscpteer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zoaA (A:)
    mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
    qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
    ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
    lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
    rqvgeqwvsyqhslahyagpwlydeniscpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zoaB (B:)
    mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
    qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
    ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
    lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
    rqvgeqwvsyqhslahyagpwlydeniscpteer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zoaB (B:)
    mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
    qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
    ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
    lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychadtdpyydlspasclmh
    rqvgeqwvsyqhslahyagpwlydeniscpt