PDB entry 2zo6

View 2zo6 on RCSB PDB site
Description: Crystal Structure of Kusabira-Cyan (KCY), a Cyan-Emitting GFP-Like Protein
Class: luminescent protein
Keywords: GFP-LIKE PROTEIN, LUMINESCENT PROTEIN, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2008-05-06, released 2009-05-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.164
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyan-emitting GFP-like protein, Kusabira-Cyan (KCy)
    Species: Fungia concinna [TaxId:496660]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZO6
    Domains in SCOPe 2.03: d2zo6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zo6A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkmsvikpemkmkyfmdgsvngheftvegeg
    tgkpyegkhkitldvtkggplpfafdllstvfsygnrcltkypddipdyfkqcfpggysw
    erkfefedgglaiakaeislkgncfehkstiegtfpdsspiaqnktlgwepstekmtvrd
    gsmkgddaaylklvgggnhkcyftttytakkkipnlpqshfighrissvvngtkigvmed
    aiahlypfngvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zo6A (A:)
    msvikpemkmkyfmdgsvngheftvegegtgkpyegkhkitldvtkggplpfafdllstv
    fsygnrcltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehksti
    egtfpdsspiaqnktlgwepstekmtvrdgsmkgddaaylklvgggnhkcyftttytakk
    kipnlpqshfighrissvvngtkigvmedaiahlypfn