PDB entry 2zo1

View 2zo1 on RCSB PDB site
Description: Mouse NP95 SRA domain DNA specific complex 2
Class: ligase/DNA
Keywords: Base flipping, Cell cycle, Developmental protein, DNA damage, DNA repair, DNA-binding, Ligase, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger, Oxidoreductase, Pyruvate, LIGASE/DNA COMPLEX
Deposited on 2008-05-05, released 2008-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-14, with a file datestamp of 2008-10-10.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.221
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Mus musculus [TaxId:10090]
    Gene: Np95
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2zo1b1
  • Chain 'D':
    Compound: DNA (5'-d(*dtp*dcp*dcp*dap*dtp*dgp*dcp*dgp*dcp*dtp*dgp*dap*dc)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*dgp*dtp*dcp*dap*dgp*(5cm)p*dgp*dcp*dap*dap*dtp*dgp*dg)-3')
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zo1B (B:)
    hmpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvd
    ngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkp
    vrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtr
    egkdrtrqlgltmqypegylealankeksrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zo1B (B:)
    hmpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvd
    ngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkp
    vrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtr
    egkdrtrqlgltmqypegylealank
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.