PDB entry 2zny

View 2zny on RCSB PDB site
Description: Crystal structure of the FFRP
Class: DNA binding protein
Keywords: transcription, DNA-binding, Transcription regulation, DNA BINDING PROTEIN
Deposited on 2008-05-02, released 2009-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.254
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znya1, d2znya2
  • Chain 'B':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyb1, d2znyb2
  • Chain 'C':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyc1, d2znyc2
  • Chain 'D':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyd1, d2znyd2
  • Chain 'E':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znye1, d2znye2
  • Chain 'F':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyf1, d2znyf2
  • Chain 'G':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyg1, d2znyg2
  • Chain 'H':
    Compound: Uncharacterized HTH-type transcriptional regulator PH1519
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1519
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znyh1, d2znyh2
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2znyA (A:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyA (A:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2znyB (B:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyB (B:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2znyC (C:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyC (C:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2znyD (D:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyD (D:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2znyE (E:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyE (E:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2znyF (F:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyF (F:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2znyG (G:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyG (G:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2znyH (H:)
    mgsshhhhhhssglvprgshmrvpldeidkkiikilqndgkaplreiskitglaestihe
    rirklresgvikkftaiidpealgysmlafilvkvkagkysevasnlakypeivevyett
    gdydmvvkirtknseelnnfldligsipgvegthtmivlkthkettelpik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znyH (H:)
    ldeidkkiikilqndgkaplreiskitglaestiherirklresgvikkftaiidpealg
    ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
    gsipgvegthtmivlkthkettelpi