PDB entry 2znr

View 2znr on RCSB PDB site
Description: Crystal structure of the DUB domain of human AMSH-LP
Class: hydrolase
Keywords: metal binding protein, Alternative splicing, Hydrolase, Metal-binding, Metalloprotease, Protease, Ubl conjugation pathway, Zinc
Deposited on 2008-05-01, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMSH-like protease
    Species: Homo sapiens [TaxId:9606]
    Gene: STAMBPL1, AMSHLP, KIAA1373
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FJ0 (5-177)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2znra1, d2znra2
  • Heterogens: ZN, PR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2znrA (A:)
    gpghmeglrcvvlpedlchkflqlaesntvrgietcgilcgklthneftithvivpkqsa
    gpdycdmenveelfnvqdqhdlltlgwihthptqtaflssvdlhthcsyqlmlpeaiaiv
    cspkhkdtgifrltnagmlevsackkkgfhphtkeprlfsickhvlvkdikiivldlr