PDB entry 2znp

View 2znp on RCSB PDB site
Description: Human PPAR delta ligand binding domain in complex with a synthetic agonist TIPP204
Class: transcription
Keywords: NUCLEAR RECEPTOR, PROTEIN-LIGAND COMPLEX, PPAR, Activator, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2008-04-30, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2znpa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d2znpb1, d2znpb2
  • Heterogens: B7G, K55, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2znpA (A:)
    gshmpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekg
    lvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkyg
    vheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldd
    sdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmad
    lrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znpA (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvlppykei
    svhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkd
    gllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdr
    pglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrik
    ktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2znpB (B:)
    gshmpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekg
    lvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkyg
    vheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldd
    sdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmad
    lrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2znpB (B:)
    mpqvadlkafskhiynaylknfnmtkkkarsiltghtapfvihdietlwqaekglvwlpp
    ykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasi
    vnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiil
    cgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmm
    qrikktetetslhpllqeiykd