PDB entry 2zmu

View 2zmu on RCSB PDB site
Description: Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 9.1
Class: luminescent protein
Keywords: GFP-LIKE PROTEIN, LUMINESCENT PROTEIN, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2008-04-21, released 2008-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Fungia concinna [TaxId:496660]
    Gene: mKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7B2 (Start-217)
      • chromophore (65)
    Domains in SCOPe 2.03: d2zmua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zmuA (A:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmuA (A:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs