PDB entry 2zmk

View 2zmk on RCSB PDB site
Description: Crystl structure of Basic Winged bean lectin in complex with Gal-alpha-1,4-Gal-Beta-Ethylene
Class: sugar binding protein
Keywords: Legume Lectin, Sugar binding Protein, Sugar Specificity, Glycoprotein, Lectin
Deposited on 2008-04-19, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zmka_
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zmkb_
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zmkc_
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zmkd_
  • Heterogens: MN, CA, NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zmkA (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmkA (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zmkB (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmkB (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zmkC (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmkC (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zmkD (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmkD (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg