PDB entry 2zmi

View 2zmi on RCSB PDB site
Description: Crystal Structure of Rat Vitamin D Receptor Bound to Adamantyl Vitamin D Analogs: Structural Basis for Vitamin D Receptor Antagonism and/or Partial Agonism
Class: transcription
Keywords: NUCLEAR RECEPTOR-ANTAGONIST COMPLEX, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, Activator
Deposited on 2008-04-19, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zmia_
  • Chain 'C':
    Compound: Mediator of RNA polymerase II transcription subunit 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TT2, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zmiA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zmiA (A:)
    rpklseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvi
    gfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvsk
    aghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsnt
    lqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevf
    gn
    

  • Chain 'C':
    No sequence available.