PDB entry 2zm4

View 2zm4 on RCSB PDB site
Description: Crystal structure of imidazo quinoxaline 1 bound to the kinase domain of human LCK, activated form (auto-phosphorylated on TYR394)
Class: transferase
Keywords: Tyrosine-protein kinase, ATP-binding, Phosphorylation, Signal transduction, Alternative splicing, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase
Deposited on 2008-04-11, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zm4a_
  • Heterogens: SO4, DMS, KSM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zm4A (A:)
    qtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspda
    flaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldm
    aaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpi
    kwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdn
    cpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zm4A (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftat