PDB entry 2zle

View 2zle on RCSB PDB site
Description: Cryo-EM structure of DegP12/OMP
Class: hydrolase
Keywords: DegP, HtrA, protease, chaperone, PDZ, outer membrane protein, OMP, periplasm, Hydrolase, Serine protease, Stress response, Ion transport, Phage recognition, Porin, Transmembrane, Transport
Deposited on 2008-04-09, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: EM
Resolution: 28 Å
R-factor: N/A
AEROSPACI score: -0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlea1, d2zlea2, d2zlea3
  • Chain 'B':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zleb1, d2zleb2, d2zleb3
  • Chain 'C':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlec1, d2zlec2, d2zlec3
  • Chain 'D':
    Compound: Outer membrane protein C
    Species: Escherichia coli [TaxId:562]
    Gene: ompC, meoA, par
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlee1, d2zlee2, d2zlee3
  • Chain 'F':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlef1, d2zlef2, d2zlef3
  • Chain 'G':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zleg1, d2zleg2, d2zleg3
  • Chain 'H':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zleh1, d2zleh2, d2zleh3
  • Chain 'I':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlei1, d2zlei2, d2zlei3
  • Chain 'J':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlej1, d2zlej2, d2zlej3
  • Chain 'K':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlek1, d2zlek2, d2zlek3
  • Chain 'L':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlel1, d2zlel2, d2zlel3
  • Chain 'M':
    Compound: Protease do
    Species: Escherichia coli [TaxId:562]
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlem1, d2zlem2, d2zlem3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zleA (A:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleA (A:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zleB (B:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleB (B:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zleC (C:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleC (C:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zleE (E:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleE (E:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zleF (F:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleF (F:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zleG (G:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleG (G:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zleH (H:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleH (H:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2zleI (I:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleI (I:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2zleJ (J:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleJ (J:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2zleK (K:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleK (K:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2zleL (L:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleL (L:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2zleM (M:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zleM (M:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnsggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll