PDB entry 2zlb

View 2zlb on RCSB PDB site
Description: Crystal structure of APO form of rat catechol-O-methyltransferase
Class: transferase
Keywords: TRANSFERASE, METHYLTRANSFERASE, NEUROTRANSMITTER DEGRADATION, Alternative initiation, Catecholamine metabolism, Cytoplasm, Magnesium, Membrane, Metal-binding, Phosphoprotein, S-adenosyl-L-methionine, Signal-anchor, Transmembrane, TRANSFERASE (METHYLTRANSFERASE)
Deposited on 2008-04-04, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlba_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zlbA (A:)
    gsmgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireys
    pslvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilnga
    sqdlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpd
    flayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zlbA (A:)
    dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
    lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
    ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
    vrgsssfecthyssyleymkvvdglekaiyqg