PDB entry 2zla

View 2zla on RCSB PDB site
Description: 2-Substituted-16-ene-22-thia-1alpha,25-dihydroxy-26,27-dimethyl-19-norvitamin D3 analogs: Synthesis, biological evaluation and crystal structure
Class: hormone
Keywords: Protein-ligand complex, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, HORMONE
Deposited on 2008-04-04, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zlaa_
  • Chain 'C':
    Compound: Coactivator peptide DRIP
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZLA (0-End)
  • Heterogens: VDB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zlaA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zlaA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrplsmlphladlvsysiqkvigfak
    mipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskaght
    lelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqty
    ircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    

  • Chain 'C':
    No sequence available.