PDB entry 2zl2

View 2zl2 on RCSB PDB site
Description: Crystal structure of H.pylori ClpP in complex with the peptide NVLGFTQ
Class: hydrolase
Keywords: Peptide substrate, Cytoplasm, Hydrolase, Protease, Serine protease
Deposited on 2008-04-02, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zl2n_
  • Chain 'O':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'P':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (Start-6)
  • Chain 'Q':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'R':
    Compound: A peptide substrate-NVLGFTQ for Chain R and S
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'S':
    Compound: A peptide substrate-NVLGFTQ for Chain R and S
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'T':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'U':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2
  • Chain 'V':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'W':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)
  • Chain 'X':
    Compound: A peptide substrate-NVLGFTQ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZL2 (0-End)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zl2A (A:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2A (A:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zl2B (B:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2B (B:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zl2C (C:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2C (C:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zl2D (D:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2D (D:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zl2E (E:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2E (E:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zl2F (F:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2F (F:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zl2G (G:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2G (G:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zl2H (H:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2H (H:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2zl2I (I:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2I (I:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2zl2J (J:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2J (J:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2zl2K (K:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2K (K:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2zl2L (L:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2L (L:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2zl2M (M:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2M (M:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2zl2N (N:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaasmgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl2N (N:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.