PDB entry 2zkm

View 2zkm on RCSB PDB site
Description: Crystal Structure of Phospholipase C Beta 2
Class: Hydrolase
Keywords: phospholipase C, phosphoinositide phospholipase, PLC-Beta-2, Calcium, Coiled coil, Hydrolase, Lipid degradation, Metal-binding, Transducer
Deposited on 2008-03-26, released 2008-08-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLC beta 2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zkmx1, d2zkmx2, d2zkmx3, d2zkmx4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2zkmX (X:)
    msllnpvllppkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemefld
    itsirdtrfgkfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsyke
    nvgkawaedvlalvkhpltanasrstfldkilvklkmqlnsegkipvknffqmfpadrkr
    veaalsachlpkgkndainpedfpepvyksflmslcprpeideiftsyhakakpymtkeh
    ltkfinqkqrdsrlnsllfpparpdqvqglidkyepsginaqrgqlspegmvwflcgpen
    svlaqdklllhhdmtqplnhyfinsshntyltagqfsglssaemyrqvllsgcrcveldc
    wkgkppdeepiithgftmttdiffkeaieaiaesafktspypiilsfenhvdsprqqakm
    aeycrtifgdmllteplekfplkpgvplpspedlrgkiliknkknqfsgptssskdtgge
    aegssppsapavwageegteleeeeveeeeeeesgnldeeeikkmqsdegtaglevtaye
    emsslvnyiqptkfvsfefsaqknrsyvissftelkaydllskasvqfvdynkrqmsriy
    pkgtrmdssnympqmfwnagcqmvalnfqtmdlpmqqnmavfefngqsgyllkhefmrrp
    dkqfnpfsvdridvvvattlsitvisgqflsersvrtyvevelfglpgdpkrryrtklsp
    stnsinpvwkeepfvfekilmpelaslrvavmeegnkflghriipinalnsgyhhlclhs
    esnmpltmpalfiflemkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zkmX (X:)
    pkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemeflditsirdtrfg
    kfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsykenvgkawaedv
    lalvkhpltanasrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachl
    pkgkndainpedfpepvyksflmslcprpeideiftymtkehltkfinqkqrqvqglidk
    yepslspegmvwflcgpensvlaqdklllhhdmtqplnhyfinsshntyltagqfsglss
    aemyrqvllsgcrcveldcwkgkppdeepiithgftmttdiffkeaieaiaesafktspy
    piilsfenhvdsprqqakmaeycrtifgdmllteplekfplkpgvplpspedlrgkilik
    nkknnldeeeikkmqsdegtaglevtayeemsslvnyiqptkfvsfefsaqknrsyviss
    ftelkaydllskasvqfvdynkrqmsriypkgtrmdssnympqmfwnagcqmvalnfqtm
    dlpmqqnmavfefngqsgyllkhefmrrpdkqfnpfsvdridvvvattlsitvisgqfls
    ersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfekilmpelaslrvav
    meegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflemkd