PDB entry 2zk9

View 2zk9 on RCSB PDB site
Description: Crystal Structure of Protein-glutaminase
Deposited on 2008-03-13, released 2009-03-17
The last revision was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.098
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Protein-glutaminase
    Species: Chryseobacterium proteolyticum [TaxId:118127]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AQQ8 (0-184)
      • see remark 999 (20)
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >2zk9X (X:)
lasvipdvatlnslfnqiknescgtstasspcitfrypvdgcyarahkmrqilmnngydc
ekqfvygnlkastgtccvawsyhvailvsyknasgvtekriidpslfssgpvtdtawrna
cvntscgsasvssyantagnvyyrspsnsylydnnlintncvltkfsllsgcspspapdv
sscgf