PDB entry 2zjw

View 2zjw on RCSB PDB site
Description: Crystal structure of human CK2 alpha complexed with Ellagic acid
Class: transferase
Keywords: protein-inhibitor complex, ATP-binding, Kinase, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2008-03-11, released 2009-03-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zjwa_
  • Heterogens: REF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zjwA (A:)
    gplgsmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfe
    ainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfeh
    vnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlid
    wglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhg
    hdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvsp
    ealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjwA (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqa