PDB entry 2zjs

View 2zjs on RCSB PDB site
Description: Crystal Structure of SecYE translocon from Thermus thermophilus with a Fab fragment
Class: protein transport/immune system
Keywords: Translocon, Sec, Protein-conducting-channel, Membrane, Protein transport, Translocation, Transmembrane, Transport, PROTEIN TRANSPORT-IMMUNE SYSTEM COMPLEX
Deposited on 2008-03-08, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.246
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Preprotein translocase secE subunit
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab56 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZJS (0-End)
    Domains in SCOPe 2.06: d2zjsh1
  • Chain 'L':
    Compound: Fab56 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZJS (0-213)
  • Chain 'Y':
    Compound: Preprotein translocase secY subunit
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KZP3 (0-End)
      • engineered (1)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zjsH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssywiawvkqrpghglewigeilpgsgstny
    nekfkgkatftadtssntaymqlssltsedsavyycarspyyygnwdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjsH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssywiawvkqrpghglewigeilpgsgstny
    nekfkgkatftadtssntaymqlssltsedsavyycarspyyygnwdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    No sequence available.

  • Chain 'Y':
    No sequence available.