PDB entry 2zjc

View 2zjc on RCSB PDB site
Description: TNFR1 selectve TNF mutant; R1-6
Class: Cytokine
Keywords: phage display system, TNFR1 selectivity, TNF, agonist, mutant, Cytokine, Lipoprotein, Membrane, Myristate, Phosphoprotein, Secreted, Signal-anchor, Transmembrane
Deposited on 2008-03-05, released 2009-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (28)
      • engineered (30-31)
      • engineered (64)
      • engineered (89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
      • engineered (145-146)
    Domains in SCOPe 2.06: d2zjca_
  • Chain 'B':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (28)
      • engineered (30-31)
      • engineered (64)
      • engineered (89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
      • engineered (145-146)
    Domains in SCOPe 2.06: d2zjcb_
  • Chain 'C':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Gene: TNF, TNFA, TNFSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (28)
      • engineered (30-31)
      • engineered (64)
      • engineered (89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
      • engineered (145-146)
    Domains in SCOPe 2.06: d2zjcc_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zjcA (A:)
    vrsssrtpsdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfastgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjcA (A:)
    psdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfastgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zjcB (B:)
    vrsssrtpsdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfastgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjcB (B:)
    tpsdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsg
    qgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiylggvfql
    epgdrlsaeinrpdyldfastgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zjcC (C:)
    vrsssrtpsdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfastgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zjcC (C:)
    psdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfastgqvyfgiial