PDB entry 2zis

View 2zis on RCSB PDB site
Description: Crystal Structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and FPP
Class: transferase
Keywords: Prenyltransferase, Transferase, Metal-binding, Phosphoprotein
Deposited on 2008-02-22, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04631
      • engineered (155)
    Domains in SCOPe 2.07: d2zisa_
  • Chain 'B':
    Compound: Protein farnesyltransferase subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zisb_
  • Heterogens: ZN, FPP, NH8, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zisA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zisA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zisB (B:)
    gshmassssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqe
    vfssykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldep
    ipqivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekl
    lqylyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweg
    giggvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvd
    gcysfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgks
    rdfyhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflq
    kpvpgfeecedavtsdpatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zisB (B:)
    plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
    lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
    ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
    rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
    lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
    alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
    lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpg