PDB entry 2zil

View 2zil on RCSB PDB site
Description: Crystal Structure of Human Lysozyme from Urine
Class: hydrolase
Keywords: HYDROLASE, secreted protein from urine, Amyloid, Antimicrobial, Bacteriolytic enzyme, Disease mutation, Glycosidase, Polymorphism
Deposited on 2008-02-18, released 2009-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zila_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zilA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv