PDB entry 2zik

View 2zik on RCSB PDB site
Description: Crystal Structure of Human Lysozyme from Pichia pastoris
Class: hydrolase
Keywords: HYDROLASE, secreted protein from Pichia pastoris, Amyloid, Antimicrobial, Bacteriolytic enzyme, Disease mutation, Glycosidase, Polymorphism
Deposited on 2008-02-18, released 2009-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Homo sapiens [TaxId:9606]
  Gene: LYZ, LZM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
  Domains in SCOPe 2.08: d2zika_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zikA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv