PDB entry 2zhz

View 2zhz on RCSB PDB site
Description: Crystal structure of a pduO-type ATP:cobalamin adenosyltransferase from Burkholderia thailandensis
Class: transferase
Keywords: helix bundle, TRANSFERASE
Deposited on 2008-02-12, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhza_
  • Chain 'B':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhzb_
  • Chain 'C':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhzc_
  • Heterogens: MG, GOL, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhzA (A:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhzA (A:)
    ddariaaigdvdelnsqigvllaeplpddvraalsaiqhdlfdlggelcipghaaitdah
    larldgwlahyngqlppleefilpggargaalahvcrtvcrraersivalgaseplnaap
    rryvnrlsdllfvlarvlnraaggadvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zhzB (B:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhzB (B:)
    lskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvraalsa
    iqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaalahvc
    rtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zhzC (C:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhzC (C:)
    lskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvraalsa
    iqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaalahvc
    rtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvl