PDB entry 2zhy

View 2zhy on RCSB PDB site
Description: Crystal structure of a pduO-type ATP:cobalamin adenosyltransferase from Burkholderia thailandensis
Class: transferase
Keywords: helix bundle, Transferase
Deposited on 2008-02-11, released 2008-07-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.229
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zhya_
  • Chain 'B':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zhyb_
  • Chain 'C':
    Compound: ATP:cob(I)alamin adenosyltransferase, putative
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: pduo
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zhyc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhyA (A:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhyA (A:)
    dariaaigdvdelnsqigvllaeplpddvraalsaiqhdlfdlggelcipghaaitdahl
    arldgwlahyngqlppleefilpggargaalahvcrtvcrraersivalgaseplnaapr
    ryvnrlsdllfvlarvlnraaggadvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zhyB (B:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhyB (B:)
    skiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvraalsai
    qhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaalahvcr
    tvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zhyC (C:)
    mgnrlskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvra
    alsaiqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaal
    ahvcrtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraaggadvlwdrt
    rah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhyC (C:)
    lskiatrtgddgttglgdgsrvrkddariaaigdvdelnsqigvllaeplpddvraalsa
    iqhdlfdlggelcipghaaitdahlarldgwlahyngqlppleefilpggargaalahvc
    rtvcrraersivalgaseplnaaprryvnrlsdllfvlarvlnraag