PDB entry 2zhs

View 2zhs on RCSB PDB site
Description: Crystal structure of BACE1 at pH 4.0
Class: hydrolase
Keywords: pH 4.0, Alternative splicing, Aspartyl protease, Glycoprotein, Hydrolase, Membrane, Protease, Transmembrane, Zymogen
Deposited on 2008-02-08, released 2008-04-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-27, with a file datestamp of 2008-05-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: HOMO SAPIENS
    Gene: BACE1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2zhsa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhsA (A:)
    mretdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavga
    aphpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaai
    tesdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfpln
    qsevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeyny
    dksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpv
    islylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfy
    vvfdrarkrigfavsachvhdefrtaavegpfvtldmedcgynipqtdest
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhsA (A:)
    fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
    tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
    lglayaeiarpddslepffdslvkqthvpnlfslqlcgaasvggsmiiggidhslytgsl
    wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
    kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
    vddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfv
    tldmedcgyn