PDB entry 2zhr

View 2zhr on RCSB PDB site
Description: Crystal structure of BACE1 in complex with OM99-2 at pH 5.0
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: OM99-2 complex, pH 5.0, Aspartyl protease, Glycoprotein, Membrane, Protease, Transmembrane, Zymogen, HYDROLASE-HYDROLASE inhibitor COMPLEX
Deposited on 2008-02-08, released 2008-04-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zhra_
  • Chain 'B':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zhrb_
  • Chain 'C':
    Compound: inhibitor OM99-2
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZHR (0-6)
  • Chain 'D':
    Compound: inhibitor OM99-2
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZHR (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhrA (A:)
    mretdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavga
    aphpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaai
    tesdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfpln
    qsevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeyny
    dksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpv
    islylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfy
    vvfdrarkrigfavsachvhdefrtaavegpfvtldmedcgynipqtdest
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhrA (A:)
    rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
    lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
    egilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmi
    iggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlr
    lpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqs
    fritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfa
    vsachvhdefrtaavegpfvtldmedcgyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zhrB (B:)
    mretdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavga
    aphpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaai
    tesdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfpln
    qsevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeyny
    dksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpv
    islylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfy
    vvfdrarkrigfavsachvhdefrtaavegpfvtldmedcgynipqtdest
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhrB (B:)
    fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
    tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
    lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
    idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
    kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
    tilpqqylrpvedvsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsach
    vhdefrtaavegpfvtldmedcgyn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.