SCOPe 2.07: Structural Classification of Proteins

PDB entry 2zhn

View 2zhn on RCSB PDB site
Description: Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine trimer (crystal 2)
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, sugar binding protein
Deposited on 2008-02-06, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.182
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Galectin-9
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot O00182
Domains in SCOPe 2.07: d2zhna_
Heterogens: RPN, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2zhnA (A:)
mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
qyfhrvpfhrvdtisvngsvqlsyisfq

Sequence, based on observed residues (ATOM records): (download)

>2zhnA (A:)
fsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhf
nprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqy
fhrvpfhrvdtisvngsvqlsyisf