PDB entry 2zhl

View 2zhl on RCSB PDB site
Description: Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 2)
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, sugar binding protein
Deposited on 2008-02-06, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhla_
  • Chain 'B':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhlb_
  • Chain 'C':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhlc_
  • Chain 'D':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhlA (A:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhlA (A:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zhlB (B:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhlB (B:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zhlC (C:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhlC (C:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zhlD (D:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhlD (D:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq