PDB entry 2zhk

View 2zhk on RCSB PDB site
Description: Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 1)
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, GALECTIN, Secreted, SUGAR BINDING PROTEIN
Deposited on 2008-02-06, released 2008-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zhka_
  • Chain 'B':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zhkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhkA (A:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhkA (A:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zhkB (B:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhkB (B:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq